PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.250350.1
Common NameCsa_2G297180
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family WRKY
Protein Properties Length: 206aa    MW: 22624.9 Da    PI: 6.2709
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.250350.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY98.25.1e-31127185159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +dDgy+WrKYG+K+vk+s++pr+YY+C+s+gC+vkkkver++ed ++v++tYeg Hnhe
  Cucsa.250350.1 127 MDDGYKWRKYGKKSVKNSPNPRNYYKCSSEGCNVKKKVERDREDANYVITTYEGIHNHE 185
                     59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.8E-33115187IPR003657WRKY domain
SuperFamilySSF1182901.14E-27120187IPR003657WRKY domain
PROSITE profilePS5081131.755122187IPR003657WRKY domain
SMARTSM007745.6E-35127186IPR003657WRKY domain
PfamPF031069.7E-24128185IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MASFPYEDSN LNPNPNPNNY THFPPILDPA SFFDFELSDF LLFGDDNNIV VDQVASSSPS  60
MTSSEKITSG GVDSGGSSTV IDTGSSVVVS SSGASTTSIR SKNGEKKRKG EMGCRVAFRT  120
KSEQEIMDDG YKWRKYGKKS VKNSPNPRNY YKCSSEGCNV KKKVERDRED ANYVITTYEG  180
IHNHESPFVV YYNQLPSFTS ASTPT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A2e-25115187274WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN6564100.0JN656410.1 UNVERIFIED: Cucumis sativus clone 12 WRKY6 transcription factor-like mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004148451.11e-151PREDICTED: probable WRKY transcription factor 51
SwissprotQ93WU97e-49WRK51_ARATH; Probable WRKY transcription factor 51
TrEMBLA0A0A0LM411e-113A0A0A0LM41_CUCSA; Uncharacterized protein
STRINGVIT_07s0031g01710.t011e-57(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF112034110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64810.13e-43WRKY DNA-binding protein 51
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]